PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_5BS_037093F0B.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family Dof
Protein Properties Length: 344aa    MW: 35444.4 Da    PI: 8.6945
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_5BS_037093F0B.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof120.65.7e-38111168562
                 zf-Dof   5 alkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                            +l+cprCds+ntkfCy+nnyslsqPr+fCkaCrryWt+GGalrnvPvGgg+r+n k+s
  Traes_5BS_037093F0B.1 111 TLRCPRCDSANTKFCYFNNYSLSQPRHFCKACRRYWTRGGALRNVPVGGGCRRNTKRS 168
                            679***************************************************9886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-3194164IPR003851Zinc finger, Dof-type
PfamPF027011.6E-31112166IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.273112166IPR003851Zinc finger, Dof-type
PROSITE patternPS013610114150IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 344 aa     Download sequence    Send to blast
MVFSSFPIFL DPPSWAQMQQ QPLQCFMGGG GGSEHQHHQL IPASSGQLAP LPDVPGNTAA  60
SAPPVAGSSS ASLQLVVSGQ QGNPGEQPPR PSVSMTERAR MARVPLPEPG TLRCPRCDSA  120
NTKFCYFNNY SLSQPRHFCK ACRRYWTRGG ALRNVPVGGG CRRNTKRSSK KSSRQGQGQG  180
GGGAVAAATS SSSTTSTSTT TSAAAATAAD VIASMQALPH HLGGLPAAAA LEASLEGYHS  240
HSHHQHHNLP FLPPQFLQQG LHGYHIADGD IGSQLADGFP RGVASGLLAQ LASIKMEEHG  300
AGAGGAGGGF VGAHEQYWPG SGGGGGWPTE FLSGFSSSSS GNVM
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3717790.0AK371779.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2141F19.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008668091.11e-109PREDICTED: uncharacterized protein LOC100273972 isoform X1
SwissprotQ9M2U17e-41DOF36_ARATH; Dof zinc finger protein DOF3.6
TrEMBLW5FL160.0W5FL16_WHEAT; Uncharacterized protein
STRINGMLOC_74620.11e-173(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14037367
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02460.14e-38Dof family protein
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]